Products

SARS-CoV-2 Nucleocapsid Protein (Omicron B1.1.529 Variant), Tag Free

No. Size Price Qty Status
C11024-100UG 100 ug $680.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Source :
Escherichia coli

Sequence :
MSDNGPQNQRNALRITFGGPSDSTGSNQNGGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRR
IRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSR
SSSRSRNSSRNSTPGSSKRTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFG
RRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTE
PKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

Endotoxin level :
<0.1 EU per 1 μg of the protein by the LAL method.

Purity :
>90% as determined by SDS-PAGE analysis. Purified by chromatography.

Formulation :
The protein was lyophilized from a solution containing 1X PBS with 0.5 M NaCl, pH 7.4.

Reconstitution :
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage :
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note :
Please use within one month after protein reconstitution.